PDB entry 1kxt

View 1kxt on RCSB PDB site
Description:
Deposited on 2002-02-01, released 2002-06-19
The last revision prior to the SCOP 1.65 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxta1, d1kxta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxtb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxtc1, d1kxtc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxtd_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxte1, d1kxte2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxtf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxtA (A:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kxtB (B:)
    qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
    dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxtB (B:)
    qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads
    vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq
    vtv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxtC (C:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kxtD (D:)
    qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
    dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxtD (D:)
    qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads
    vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq
    vtv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxtE (E:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kxtF (F:)
    qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
    dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxtF (F:)
    qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads
    vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq
    vtv