PDB entry 1kxn

View 1kxn on RCSB PDB site
Description: Crystal Structure of Cytochrome c Peroxidase with a Proposed Electron Transfer Pathway Excised to Form a Ligand Binding Channel.
Class: oxidoreductase
Keywords: engineered heme channel, OXIDOREDUCTASE
Deposited on 2002-02-01, released 2002-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP-MKT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-288)
      • engineered (186)
    Domains in SCOPe 2.05: d1kxna_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxnA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
    sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl