PDB entry 1kxm

View 1kxm on RCSB PDB site
Description: crystal structure of cytochrome c peroxidase with a proposed electron transfer pathway excised to form a ligand binding channel.
Deposited on 2002-02-01, released 2002-03-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kxma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxmA (A:)
    tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
    knsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpky
    lsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl