PDB entry 1kxl

View 1kxl on RCSB PDB site
Description: Solution Structure of the Cdc13 DNA-binding Domain in a Complex with Single-Stranded Telomeric DNA (DNA structure not modeled)
Class: cell cycle
Keywords: DNA-binding domain, telomere, single-stranded DNA, OB fold, CELL CYCLE
Deposited on 2002-01-31, released 2002-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division control protein 13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kxla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kxlA (A:)
    mrmskmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqn
    ylydrylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygi
    vckmnikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisr
    yfeeyrrffpihrngshla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxlA (A:)
    kmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqnylyd
    rylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygivckm
    nikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisryfee
    yrrffpi