PDB entry 1kxi

View 1kxi on RCSB PDB site
Description: structure of cytotoxin homolog precursor
Class: cytotoxin
Keywords: venom, cytotoxin, cardiotoxin, multigene family, signal
Deposited on 1996-08-29, released 1997-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiotoxin v
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kxia_
  • Chain 'B':
    Compound: cardiotoxin v
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kxib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxiA (A:)
    lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
    cn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxiB (B:)
    lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
    cn