PDB entry 1kxf

View 1kxf on RCSB PDB site
Description: sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)
Deposited on 1996-05-05, released 1996-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1kxf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1kxf_ (-)
    mnrgffnmlgrrpfpaptamwrprrrrqaapmparnglasqiqqlttavsalvigqatrp
    qnprprppprqkkqapkqppkpkkpkpqekkkkqpaktkpgkrqrmalkleadrlfdvkn
    edgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnmrseafty
    tsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlggadegtrt
    alsvvtwnskgktikttpegteew
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxf_ (-)
    malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
    faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
    vvaivlggadegtrtalsvvtwnskgktikttpegteew