PDB entry 1kxf

View 1kxf on RCSB PDB site
Description: sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form II)
Class: Viral protein
Keywords: SINDBIS VIRUS CAPSID PROTEIN, CHYMOTRYPSIN-LIKE SERINE PROTEINASE, WILD TYPE, VIRUS CAPSID PROTEIN, Viral protein
Deposited on 1996-05-05, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sindbis virus capsid protein
    Species: Sindbis virus [TaxId:11034]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kxfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxfA (A:)
    malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
    faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
    vvaivlggadegtrtalsvvtwnskgktikttpegteew