PDB entry 1kxe

View 1kxe on RCSB PDB site
Description:
Deposited on 1996-05-05, released 1996-11-08
The last revision prior to the SCOP 1.65 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.188
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1kxe_ (-)
    malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
    faqlpvnmrseaftstsghpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
    vvaivlggadegtrtalsvvtwnskgktikttpegteew
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxe_ (-)
    lkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefa
    qlpvnmrseaftstsghpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvv
    aivlggadegtrtalsvvtwnskgktikttpegteew