PDB entry 1kx5

View 1kx5 on RCSB PDB site
Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
Class: structural protein/DNA
Keywords: nucleosome, chromatin, histone, protein-DNA interaction, nucleoprotein, supercoiled DNA, nucleosome core, protein-DNA complex, DNA bending, DNA curvature, DNA-cation binding, DNA-metal binding, DNA solvation, structural protein/DNA complex
Deposited on 2002-01-31, released 2002-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16105 (0-134)
      • conflict (101)
    Domains in SCOPe 2.06: d1kx5a_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kx5b_
  • Chain 'C':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (0-127)
      • variant (98)
      • conflict (122)
    Domains in SCOPe 2.06: d1kx5c_
  • Chain 'D':
    Compound: histone h2b.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • variant (31)
    Domains in SCOPe 2.06: d1kx5d_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16105 (0-134)
      • conflict (101)
    Domains in SCOPe 2.06: d1kx5e_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kx5f_
  • Chain 'G':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (0-127)
      • variant (98)
      • conflict (122)
    Domains in SCOPe 2.06: d1kx5g_
  • Chain 'H':
    Compound: histone h2b.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • variant (31)
    Domains in SCOPe 2.06: d1kx5h_
  • Chain 'I':
    Compound: DNA (5'(atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctccatcaaaaggcatgttcagctggaatccagctgaacatgccttttgatggagcagtttccaaatacacttttggtagtatctgcaggtggatattgat)3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (5'(atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctccatcaaaaggcatgttcagctggattccagctgaacatgccttttgatggagcagtttccaaatacacttttggtagtatctgcaggtggatattgat)3')
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5A (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5B (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5C (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kx5D (D:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx5D (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5E (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5F (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kx5G (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kx5H (H:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx5H (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.