PDB entry 1kx3

View 1kx3 on RCSB PDB site
Description: X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
Class: structural protein/DNA
Keywords: nucleosome, chromatin, histone, protein-DNA interaction, nucleoprotein, supercoiled DNA, nucleosome core, protein-DNA complex, structural protein/DNA complex
Deposited on 2002-01-31, released 2002-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.07: d1kx3a_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kx3b_
  • Chain 'C':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kx3c_
  • Chain 'D':
    Compound: histone h2b.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • variant (31)
    Domains in SCOPe 2.07: d1kx3d_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.07: d1kx3e_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kx3f_
  • Chain 'G':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kx3g_
  • Chain 'H':
    Compound: histone h2b.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • variant (31)
    Domains in SCOPe 2.07: d1kx3h_
  • Chain 'I':
    Compound: DNA (5'(atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctccatcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggagcagtttccaaatacacttttggtagaatctgcaggtggatattgat)3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (5'(atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctccatcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggagcagtttccaaatacacttttggtagaatctgcaggtggatattgat)3')
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kx3A (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3A (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kx3B (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3B (B:)
    vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
    vtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kx3C (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3C (C:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kx3D (D:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3D (D:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kx3E (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3E (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kx3F (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3F (F:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1kx3G (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3G (G:)
    aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kx3H (H:)
    pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
    imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx3H (H:)
    trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.