PDB entry 1kww

View 1kww on RCSB PDB site
Description: Rat mannose protein A complexed with a-Me-Fuc.
Class: immune system, sugar binding protein
Keywords: lectin, c-type lectin, calcium-binding protein, immune system, sugar binding protein
Deposited on 2002-01-30, released 2002-07-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kwwa1, d1kwwa2
  • Chain 'B':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kwwb1, d1kwwb2
  • Chain 'C':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kwwc1, d1kwwc2
  • Heterogens: MFU, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwwA (A:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwwB (B:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwwC (C:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa