PDB entry 1kwv

View 1kwv on RCSB PDB site
Description: Rat mannose binding protein A complexed with a-Me-GlcNAc
Class: immune system, sugar binding protein
Keywords: lectin, c-type lectin, calcium-binding protein, immune system, sugar binding protein
Deposited on 2002-01-30, released 2002-07-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1kwva1, d1kwva2
  • Chain 'B':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1kwvb1, d1kwvb2
  • Chain 'C':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1kwvc1, d1kwvc2
  • Heterogens: NAG, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwvA (A:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwvB (B:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwvC (C:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa