PDB entry 1kws

View 1kws on RCSB PDB site
Description: crystal structure of beta1,3-glucuronyltransferase I in complex with the active udp-glcua donor
Class: transferase
Keywords: DXD, NTP binding domain, TRANSFERASE
Deposited on 2002-01-30, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,3-glucuronyltransferase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94766 (1-260)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1kwsa1, d1kwsa2
  • Chain 'B':
    Compound: beta-1,3-glucuronyltransferase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94766 (1-260)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1kwsb_
  • Heterogens: MN, UGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kwsA (A:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltpkaqrlregepgwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfad
    ddntysrelfeemrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdma
    gfavalpllldkpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekp
    kmkqeeqlqrqgrgsdpaiev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwsA (A:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltpwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadddntysrelfe
    emrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdmagfavalpllld
    kpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekpkmkqeeqlqrq
    grgsdpaiev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kwsB (B:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltpkaqrlregepgwvhprgveqrnkaldwlrgrggavggekdppppgtqgvvyfad
    ddntysrelfeemrwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawepsrpfpvdma
    gfavalpllldkpnaqfdstaprghlessllshlvdpkdlepraanctrvlvwhtrtekp
    kmkqeeqlqrqgrgsdpaiev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwsB (B:)
    mtiyvvtptyarlvqkaelvrlsqtlslvprlhwllvedaegptplvsgllaasgllfth
    lvvltphprgveqrnkaldwlrgrggavggekdppppgtqgvvyfadddntysrelfeem
    rwtrgvsvwpvglvgglrfegpqvqdgrvvgfhtawerpfpvdmagfavalpllldkpna
    qfdstapghlessllshlvdpkdlepraanctrvlvwhtrtekpkmkqeeqlqrqgrgsd
    paiev