PDB entry 1kwo

View 1kwo on RCSB PDB site
Description: SCALLOP MYOSIN S1-ATPgammaS-p-PDM IN THE ACTIN-DETACHED CONFORMATION
Class: contractile protein
Keywords: Actin-detached, Myosin, Mechanics of Motor, Cross linker
Deposited on 2002-01-30, released 2002-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.238
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kwoa1, d1kwoa2
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kwob_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kwoc_
  • Heterogens: CA, MG, AGS, PDM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kwoA (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwoA (A:)
    fsdpdfqylavdrkklmkeafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstr
    tvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyr
    rlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentk
    kvimylakvacavkkegsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgk
    iagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgc
    ltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqrpreeqaesdg
    taeaekvaflcginagdllkallkpkvkvgvtkgqnmnqvvnsvgalakslydrmfnwlv
    rrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqee
    ykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgkn
    rmftrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplvaelfkaf
    qtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlrkgfp
    srliysefkqrysilapndgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrd
    erlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kwoB (B:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwoB (B:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgsgee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kwoC (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwoC (C:)
    klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
    vdeiikltdlqedlegnvkyedfvkkvmagpyp