PDB entry 1kwm

View 1kwm on RCSB PDB site
Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)
Class: hydrolase
Keywords: HYDROLASE, Procarboxypeptidase B
Deposited on 2002-01-30, released 2002-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.136
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Procarboxypeptidase B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kwma1, d1kwma2
  • Chain 'B':
    Compound: Procarboxypeptidase B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kwmb1, d1kwmb2
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwmA (A:)
    hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
    tvtvenvlkqnelqykvlisnlrnvveaqfdsrvratghsyekynkwetieawtqqvate
    npalisrsvigttfegraiyllkvgkagqnkpaifmdcgfharewispafcqwfvreavr
    tygreiqvtellnkldfyvlpvlnidgyiytwtksrfwrktrsthtgsscigtdpnrnfd
    agwceigasrnpcdetycgpaaeseketkaladfirnklssikayltihsysqmmiypys
    yayklgennaelnalakatvkelaslhgtkytygpgattiypaaggsddwaydqgirysf
    tfelrdtgrygfllpesqiratceetflaikyvasyvlehly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwmB (B:)
    hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
    tvtvenvlkqnelqykvlisnlrnvveaqfdsrvratghsyekynkwetieawtqqvate
    npalisrsvigttfegraiyllkvgkagqnkpaifmdcgfharewispafcqwfvreavr
    tygreiqvtellnkldfyvlpvlnidgyiytwtksrfwrktrsthtgsscigtdpnrnfd
    agwceigasrnpcdetycgpaaeseketkaladfirnklssikayltihsysqmmiypys
    yayklgennaelnalakatvkelaslhgtkytygpgattiypaaggsddwaydqgirysf
    tfelrdtgrygfllpesqiratceetflaikyvasyvlehly