PDB entry 1kwm

View 1kwm on RCSB PDB site
Description: Human procarboxypeptidase B: Three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI)
Deposited on 2002-01-30, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.136
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwmA (A:)
    hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
    tvtvenvlkqnelqykvlisnlrnvveaqfdsrvratghsyekynkwetieawtqqvate
    npalisrsvigttfegraiyllkvgkagqnkpaifmdcgfharewispafcqwfvreavr
    tygreiqvtellnkldfyvlpvlnidgyiytwtksrfwrktrsthtgsscigtdpnrnfd
    agwceigasrnpcdetycgpaaeseketkaladfirnklssikayltihsysqmmiypys
    yayklgennaelnalakatvkelaslhgtkytygpgattiypaaggsddwaydqgirysf
    tfelrdtgrygfllpesqiratceetflaikyvasyvlehly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwmB (B:)
    hhggehfegekvfrvnvedenhiniirelasttqidfwkpdsvtqikphstvdfrvkaed
    tvtvenvlkqnelqykvlisnlrnvveaqfdsrvratghsyekynkwetieawtqqvate
    npalisrsvigttfegraiyllkvgkagqnkpaifmdcgfharewispafcqwfvreavr
    tygreiqvtellnkldfyvlpvlnidgyiytwtksrfwrktrsthtgsscigtdpnrnfd
    agwceigasrnpcdetycgpaaeseketkaladfirnklssikayltihsysqmmiypys
    yayklgennaelnalakatvkelaslhgtkytygpgattiypaaggsddwaydqgirysf
    tfelrdtgrygfllpesqiratceetflaikyvasyvlehly