PDB entry 1kwf

View 1kwf on RCSB PDB site
Description: atomic resolution structure of an inverting glycosidase in complex with substrate
Deposited on 2002-01-29, released 2002-03-13
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: 0.094
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1kwfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwfA (A:)
    agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
    vsqgmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
    adedialalifadklwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
    psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
    ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
    nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
    sdl