PDB entry 1kwf

View 1kwf on RCSB PDB site
Description: Atomic Resolution Structure of an Inverting Glycosidase in Complex with Substrate
Class: hydrolase
Keywords: hydrolase, inverting glycosidase, atomic resolution, protein-carbohydrate interactions, reaction mechanism, cellulase
Deposited on 2002-01-29, released 2002-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: N/A
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase A
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: CELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04955 (0-362)
      • engineered (62)
    Domains in SCOPe 2.08: d1kwfa_
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kwfA (A:)
    agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
    vsqgmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
    adedialalifadklwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
    psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
    ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
    nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
    sdl