PDB entry 1kw4

View 1kw4 on RCSB PDB site
Description: Polyhomeotic SAM domain structure
Class: DNA binding protein
Keywords: SAM domain, Polycomb Group, polymer
Deposited on 2002-01-28, released 2002-06-05
The last revision prior to the SCOP 1.75 freeze date was dated 2002-06-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.22
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyhomeotic
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39769
      • engineered (50)
      • modified residue (60)
      • modified residue (62)
    Domains in SCOP 1.75: d1kw4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kw4A (A:)
    metkrvngtdrppisswsvddvsnfirelpgcqdyvddfiqqeidgqallrlkekhlvna
    mgmklgpalkivakvesikevrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kw4A (A:)
    drppisswsvddvsnfirelpgcqdyvddfiqqeidgqallrlkekhlvnamgmklgpal
    kivakvesik