PDB entry 1kw2

View 1kw2 on RCSB PDB site
Description: crystal structure of uncomplexed vitamin d-binding protein
Deposited on 2002-01-28, released 2002-06-19
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kw2A (A:)
    grdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaega
    dpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyvep
    tndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcf
    lkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaedit
    nilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaq
    lpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdve
    dsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpkela
    klvnkrsdfasnccsinspplycdseidaelknil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kw2B (B:)
    dyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaegadp
    dcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyveptn
    deiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcflk
    erlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditni
    lskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlp
    elpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdveds
    ttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpkelakl
    vnkrsdfasnccsinspplycdseidaelknil