PDB entry 1kw1

View 1kw1 on RCSB PDB site
Description: Crystal Structure of 3-Keto-L-Gulonate 6-Phosphate Decarboxylase with bound L-gulonate 6-phosphate
Class: lyase
Keywords: beta/alpha-barrel, LYASE
Deposited on 2002-01-28, released 2002-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kw1a_
  • Chain 'B':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kw1b_
  • Heterogens: MG, LG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kw1A (A:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kw1A (A:)
    lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
    akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
    qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
    ipihvfiagrsirdaaspveaarqfkrsiaelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kw1B (B:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kw1B (B:)
    slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
    dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
    aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
    gipihvfiagrsirdaaspveaarqfkrsiaelwg