PDB entry 1kvz

View 1kvz on RCSB PDB site
Description: Solution Structure of Cytotoxic RC-RNase4
Class: hydrolase
Keywords: antitumor, bullfrog, cytotoxicity,ribonuclease, NMR, Structure from MOLMOL, HYDROLASE
Deposited on 2002-01-28, released 2002-07-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RC-RNase4
  Species: Rana catesbeiana [TaxId:8400]
  Gene: Oocytes
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DFY6 (0-106)
    • initiating met (0)
  Domains in SCOPe 2.03: d1kvza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kvzA (A:)
  mqdwatfkkkhltdtwdvdcdnlmptslfdckdkntfiyslpgpvkalcrgvifsadvls
  nsefylaecnvkprkpckyklkkssnricircehelpvhfagvgicp