PDB entry 1kvz

View 1kvz on RCSB PDB site
Description: solution structure of cytotoxic rc-rnase4
Deposited on 2002-01-28, released 2002-07-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-28, with a file datestamp of 2002-07-28.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kvza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvzA (A:)
    mqdwatfkkkhltdtwdvdcdnlmptslfdckdkntfiyslpgpvkalcrgvifsadvls
    nsefylaecnvkprkpckyklkkssnricircehelpvhfagvgicp