PDB entry 1kvy

View 1kvy on RCSB PDB site
Description: carboxylic ester hydrolase, single mutant d49e coordinated to calcium
Deposited on 1998-04-29, released 1998-11-18
The last revision prior to the SCOP 1.57 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1kvy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kvy_ (-)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthencykqakklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  knc