PDB entry 1kvv

View 1kvv on RCSB PDB site
Description: Solution Structure Of Protein SRP19 Of The Archaeoglobus fulgidus Signal Recognition Particle, Minimized Average Structure
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2002-01-27, released 2002-03-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: srp19
  Species: Archaeoglobus fulgidus [TaxId:2234]
  Gene: AF1258
  Database cross-references and differences (RAF-indexed):
  • Uniprot O29010 (0-103)
    • engineered (3)
    • engineered (40)
  Domains in SCOPe 2.03: d1kvva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kvvA (A:)
  mkesvvwtvnldskksraegrriprrfavpnvklhelveaskelglkfraeekkypksww
  eeggrvvvekrgtktklmielarkiaeireqkreqkkdkkkkkk