PDB entry 1kvv

View 1kvv on RCSB PDB site
Description: solution structure of protein srp19 of the archaeoglobus fulgidus signal recognition particle, minimized average structure
Deposited on 2002-01-27, released 2002-03-20
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kvva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvvA (A:)
    mkesvvwtvnldskksraegrriprrfavpnvklhelveaskelglkfraeekkypksww
    eeggrvvvekrgtktklmielarkiaeireqkreqkkdkkkkkk