PDB entry 1kvp

View 1kvp on RCSB PDB site
Description: structural analysis of the spiroplasma virus, spv4, implications for evolutionary variation to obtain host diversity among the microviridae, electron microscopy, alpha carbons only
Class: Virus
Keywords: BACTERIOPHAGE SPV4 COAT PROTEIN, CHIMERA, Icosahedral virus
Deposited on 1997-12-12, released 1999-02-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: EM
Resolution: 27 Å
R-factor: N/A
AEROSPACI score: -2.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spv4 capsid protein vp1
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03641 (0-496)
      • insertion (187-257)
      • conflict (286)
    Domains in SCOPe 2.04: d1kvpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvpA (A:)
    sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
    dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
    khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
    rqmttstgmapvttkfrdvpnlsgtplifrdnkgrtiktgqlgigpvdagflvaqntaqa
    angeraipsnlwadlsnatsidimglqaayanlhtdqerdyfmqryrdvissfggktsyd
    adnrpllvmrsnlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalv
    rfpptatkeiqylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegq
    wyryapsyvspayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfn
    vtvyrnlpttrdsimts