PDB entry 1kvn

View 1kvn on RCSB PDB site
Description: Solution Structure Of Protein SRP19 Of The Arhaeoglobus fulgidus Signal Recognition Particle, 10 Structures
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2002-01-27, released 2002-03-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: srp19
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1258
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29010 (0-103)
      • engineered (3)
      • engineered (40)
    Domains in SCOPe 2.03: d1kvna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvnA (A:)
    mkesvvwtvnldskksraegrriprrfavpnvklhelveaskelglkfraeekkypksww
    eeggrvvvekrgtktklmielarkiaeireqkreqkkdkkkkkk