PDB entry 1kvn

View 1kvn on RCSB PDB site
Description: solution structure of protein srp19 of the arhaeoglobus fulgidus signal recognition particle, 10 structures
Deposited on 2002-01-27, released 2002-03-20
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1kvna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kvnA (A:)
  mkesvvwtvnldskksraegrriprrfavpnvklhelveaskelglkfraeekkypksww
  eeggrvvvekrgtktklmielarkiaeireqkreqkkdkkkkkk