PDB entry 1kvj

View 1kvj on RCSB PDB site
Description: Solution Structure of the Cu(I) bound form of the first heavy metal binding motif of the Menkes protein
Class: Hydrolase
Keywords: Menkes, Cu-bound, Hydrolase
Deposited on 2002-01-26, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kvja_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kvjA (A:)
mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
tlqeaiddmgfdavihnpd