PDB entry 1kvi

View 1kvi on RCSB PDB site
Description: solution structure of the reduced form of the first heavy metal binding motif of the menkes protein
Deposited on 2002-01-26, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1kvia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kviA (A:)
  mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
  tlqeaiddmgfdavihnpd