PDB entry 1kvi

View 1kvi on RCSB PDB site
Description: Solution Structure of the Reduced Form of the First Heavy Metal Binding Motif of the Menkes Protein
Class: hydrolase
Keywords: MENKES, Cu-Protein, HYDROLASE
Deposited on 2002-01-26, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kvia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kviA (A:)
    mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
    tlqeaiddmgfdavihnpd