PDB entry 1kv9

View 1kv9 on RCSB PDB site
Description: Structure at 1.9 A Resolution of a Quinohemoprotein Alcohol Dehydrogenase from Pseudomonas putida HK5
Class: oxidoreductase
Keywords: Quinohemoprotein Alcohol Dehydrogenase, electron transfer, OXIDOREDUCTASE
Deposited on 2002-01-25, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.154
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II quinohemoprotein alcohol dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kv9a1, d1kv9a2
  • Heterogens: CA, PQQ, HEM, EPE, ACN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kv9A (A:)
    agvdeaairateqaggewlshgrtyaeqrfsplkqidasnvrslglawymdldntrglea
    tplfhdgviytsmswsrviavdaasgkelwrydpevakvkartsccdavnrgvalwgdkv
    yvgtldgrlialdaktgkaiwsqqttdpakpysitgaprvvkgkviignggaeygvrgfv
    saydadtgklawrfytvpgdpalpyehpelreaaktwqgdqywklggggtvwdsmaydpe
    ldllyvgtgngspwnrevrspgggdnlylssilairpdtgklawhyqvtpgdswdftatq
    qitlaelnidgkprkvlmqapkngffyvldrtngklisaekfgkvtwaekvdlatgrpve
    apgvryekepivmwpspfgahnwhsmsfnpgtglvyipyqevpgvyrnegkdfvtrkafn
    taagfadatdvpaavvsgallawdpvkqkaawkvpypthwnggtlstagnlvfqgtaagq
    mhaysadkgealwqfeaqsgivaapmtfelagrqyvaimagwggvatltggesmnlpgmk
    nrsrllvfaldgkaqlpppapapakvervpqpvtaapeqvqagkqlygqfcsvchgmgti
    sgglipdlrqssdatrehfqqivlqgalkplgmpsfddslkpeeveqiklyvmsreyedy
    marhkaap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kv9A (A:)
    agvdeaairateqaggewlshgrtyaeqrfsplkqidasnvrslglawymdldntrglea
    tplfhdgviytsmswsrviavdaasgkelwrydpevakvkartsccdavnrgvalwgdkv
    yvgtldgrlialdaktgkaiwsqqttdpakpysitgaprvvkgkviignggaeygvrgfv
    saydadtgklawrfytvpgdpalpyehpelreaaktwqgdqywklggggtvwdsmaydpe
    ldllyvgtgngspwnrevrspgggdnlylssilairpdtgklawhyqvtpgdswdftatq
    qitlaelnidgkprkvlmqapkngffyvldrtngklisaekfgkvtwaekvdlatgrpve
    apgvryekepivmwpspfgahnwhsmsfnpgtglvyipyqevpgvyrnegkdfvtrkafn
    taagfadatdvpaavvsgallawdpvkqkaawkvpypthwnggtlstagnlvfqgtaagq
    mhaysadkgealwqfeaqsgivaapmtfelagrqyvaimagwggvatltggesmnlpgmk
    nrsrllvfaldgkaqlpppapapakvervpqpvtaapeqvqagkqlygqfcsvchgmgti
    sgglipdlrqssdatrehfqqivlqgalkplgmpsfddslkpeeveqiklyvmsreyedy
    marh