PDB entry 1kv6

View 1kv6 on RCSB PDB site
Description: X-ray structure of the orphan nuclear receptor ERR3 ligand-binding domain in the constitutively active conformation
Class: gene regulation
Keywords: transcriptionally active conformation in absence of ligand, Structural Proteomics in Europe, SPINE, Structural Genomics, GENE REGULATION
Deposited on 2002-01-25, released 2003-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kv6a_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3B3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kv6b_
  • Chain 'C':
    Compound: steroid receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: steroid receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kv6A (A:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kv6A (A:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kv6B (B:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kv6B (B:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.