PDB entry 1kv5

View 1kv5 on RCSB PDB site
Description: Structure of Trypanosoma brucei brucei TIM with the salt-bridge-forming residue Arg191 mutated to Ser
Class: isomerase
Keywords: TIM barrel, mutant, salt bridge, isomerase
Deposited on 2002-01-25, released 2002-03-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.145
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered (190)
    Domains in SCOPe 2.01: d1kv5a_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered (190)
    Domains in SCOPe 2.01: d1kv5b_
  • Heterogens: PGA, SO4, DTT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kv5A (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalisswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kv5A (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
    qaqeahalisswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kv5B (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalisswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kv5B (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
    qaqeahalisswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq