PDB entry 1kv1

View 1kv1 on RCSB PDB site
Description: p38 MAP Kinase in Complex with Inhibitor 1
Class: transferase
Keywords: protein-inhibitor complex, TRANSFERASE
Deposited on 2002-01-23, released 2002-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p38 map kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kv1a_
  • Heterogens: BMU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kv1A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kv1A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgatrwyrapeimlnwmhyn
    qtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqs
    ltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvad
    pydqsfesrdllidewksltydevisfvppp