PDB entry 1kv0

View 1kv0 on RCSB PDB site
Description: Cis/trans Isomerization of Non-prolyl Peptide Bond Observed in Crystal Structure of an Scorpion Toxin
Deposited on 2002-01-23, released 2003-09-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-16, with a file datestamp of 2003-09-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.144
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1kv0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1kv0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kv0A (A:)
vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp
grchpa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kv0B (B:)
vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp
grchpa