PDB entry 1kv0

View 1kv0 on RCSB PDB site
Description: Cis/trans Isomerization of Non-prolyl Peptide Bond Observed in Crystal Structure of an Scorpion Toxin
Class: toxin
Keywords: Non-prolyl cis peptide bond, Cis/trans isomerization, X-ray structure, Dimeric structure, Scorpion toxin
Deposited on 2002-01-23, released 2003-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.144
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-like toxin BmK-M7
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59854 (0-65)
  Domains in SCOPe 2.08: d1kv0a_
• Chain 'B':
  Compound: Alpha-like toxin BmK-M7
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59854 (0-65)
  Domains in SCOPe 2.08: d1kv0b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kv0A (A:)
  vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp
  grchpa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kv0B (B:)
  vrdgyialphncaygclnneycnnlctkdgakigycnivgkygnacwciqlpdnvpirvp
  grchpa