PDB entry 1kuy

View 1kuy on RCSB PDB site
Description: x-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
Deposited on 2002-01-22, released 2002-03-22
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-22, with a file datestamp of 2002-03-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1kuya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kuyA (A:)
    htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
    lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
    qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl