PDB entry 1kuq

View 1kuq on RCSB PDB site
Description: crystal structure of t3c mutant s15 ribosomal protein in complex with 16s rRNA
Class: ribosome
Keywords: rRNA-protein complex, RIBOSOME
Deposited on 2002-01-22, released 2003-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80378 (Start-86)
      • engineered (3)
    Domains in SCOPe 2.08: d1kuqa_
  • Chain 'B':
    Compound: 16s ribosomal RNA fragment
    Species: Thermus thermophilus [TaxId:274]
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kuqA (A:)
    mpickeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kuqA (A:)
    ckeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvgqr
    rrllrylqredperyralieklgi
    

  • Chain 'B':
    No sequence available.