PDB entry 1kun

View 1kun on RCSB PDB site
Description: solution structure of the human alpha3-chain type vi collagen c- terminal kunitz domain, nmr, 20 structures
Deposited on 1997-03-04, released 1997-11-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1kun__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kun_ (-)
    etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv