PDB entry 1kun

View 1kun on RCSB PDB site
Description: solution structure of the human alpha3-chain type vi collagen c-terminal kunitz domain, nmr, 20 structures
Class: extracellular matrix
Keywords: collagen type vi fragment, kunitz-type domain, extracellular matrix, connective tissue
Deposited on 1997-03-04, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha3-chain type vi collagen
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kuna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kunA (A:)
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv