PDB entry 1kui

View 1kui on RCSB PDB site
Description: crystal structure of a taiwan habu venom metalloproteinase complexed with peqw.
Deposited on 2002-01-22, released 2002-07-10
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kuia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kuiA (A:)
    qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
    ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
    ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
    skdyyqtfltndnpqcilnap