PDB entry 1kui

View 1kui on RCSB PDB site
Description: Crystal Structure of a Taiwan Habu Venom Metalloproteinase complexed with pEQW.
Class: hydrolase/hydrolase inhibitor
Keywords: alpha/beta protein, retro-binding manner, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2002-01-22, released 2002-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metalloproteinase
    Species: Protobothrops mucrosquamatus [TaxId:103944]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57413 (Start-202)
      • conflict (20)
      • conflict (41)
      • conflict (168)
    Domains in SCOPe 2.08: d1kuia_
  • Chain 'B':
    Compound: eqw
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1KUI (0-2)
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kuiA (A:)
    eqqrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldv
    wsekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcd
    ekysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfs
    dcskdyyqtfltndnpqcilnap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kuiA (A:)
    qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
    ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
    ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
    skdyyqtfltndnpqcilnap
    

  • Chain 'B':
    No sequence available.