PDB entry 1kuh

View 1kuh on RCSB PDB site
Description: zinc protease from streptomyces caespitosus
Class: hydrolase
Keywords: metalloproteinase, hydrolase
Deposited on 1996-02-22, released 1997-03-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc protease
    Species: Streptomyces caespitosus [TaxId:53502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kuha_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kuhA (A:)
    tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
    grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
    ersrvnalwang