PDB entry 1kuf

View 1kuf on RCSB PDB site
Description: High-resolution Crystal Structure of a Snake Venom Metalloproteinase from Taiwan Habu
Deposited on 2002-01-21, released 2002-07-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-03, with a file datestamp of 2002-07-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.181
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kufa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kufA (A:)
    qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
    ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
    ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
    skdyyqtfltndnpqcilnap