PDB entry 1kuf

View 1kuf on RCSB PDB site
Description: High-resolution Crystal Structure of a Snake Venom Metalloproteinase from Taiwan Habu
Class: hydrolase
Keywords: alpha/beta protein, HYDROLASE
Deposited on 2002-01-21, released 2002-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.181
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metalloproteinase
    Species: Protobothrops mucrosquamatus [TaxId:103944]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57413 (Start-202)
      • conflict (20)
      • conflict (41)
      • conflict (168)
    Domains in SCOPe 2.08: d1kufa_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kufA (A:)
    eqqrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldv
    wsekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcd
    ekysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfs
    dcskdyyqtfltndnpqcilnap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kufA (A:)
    qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
    ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
    ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcdtcimsavisdkqsklfsdc
    skdyyqtfltndnpqcilnap