PDB entry 1ku1

View 1ku1 on RCSB PDB site
Description: crystal structure of the sec7 domain of yeast gea2
Deposited on 2002-01-20, released 2002-03-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ku1a_
  • Chain 'B':
    Domains in SCOP 1.61: d1ku1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ku1A (A:)
    glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
    ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
    ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
    nlkgccnhkdfpfwyldrvycsirdkeivmp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ku1B (B:)
    glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
    ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
    ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
    nlkgccnhkdfpfwyldrvycsirdkeivmp