PDB entry 1ku1

View 1ku1 on RCSB PDB site
Description: Crystal Structure of the Sec7 Domain of Yeast GEA2
Class: endocytosis/exocytosis
Keywords: Sec7 domain, Guanine Nucleotide Exchange Factor (GEF), ARF small GTP-binding proteins, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2002-01-20, released 2002-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ARF guanine-nucleotide exchange factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39993 (21-End)
      • cloning artifact (12-20)
      • cloning artifact (210)
    Domains in SCOPe 2.08: d1ku1a1, d1ku1a2, d1ku1a3
  • Chain 'B':
    Compound: ARF guanine-nucleotide exchange factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39993 (21-End)
      • cloning artifact (12-20)
      • cloning artifact (210)
    Domains in SCOPe 2.08: d1ku1b1, d1ku1b2, d1ku1b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ku1A (A:)
    mgsshhhhhhssglvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdia
    eflfnnnnrmnkktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesq
    qieriieafssaycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpq
    vkehmsfedysgnlkgccnhkdfpfwyldrvycsirdkeivmpeehhgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ku1A (A:)
    glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
    ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
    ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
    nlkgccnhkdfpfwyldrvycsirdkeivmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ku1B (B:)
    mgsshhhhhhssglvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdia
    eflfnnnnrmnkktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesq
    qieriieafssaycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpq
    vkehmsfedysgnlkgccnhkdfpfwyldrvycsirdkeivmpeehhgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ku1B (B:)
    glvprgshmdrktefiectnafnekpkkgipmliekgfiasdsdkdiaeflfnnnnrmnk
    ktiglllchpdkvsllneyirlfdfsglrvdeairilltkfrlpgesqqieriieafssa
    ycenqdydpskisdnaeddistvqpdadsvfilsysiimlntdlhnpqvkehmsfedysg
    nlkgccnhkdfpfwyldrvycsirdkeivmp