PDB entry 1ktv

View 1ktv on RCSB PDB site
Description: Crystal Structure of Elongation Factor G Dimer Without Nucleotide
Class: translation
Keywords: apo form, TRANSLATION
Deposited on 2002-01-17, released 2003-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.287
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ktvA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktvA (A:)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ktvB (B:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktvB (B:)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik